.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yc5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Mechanism of sirtuin inhibition by nicotinamide: altering the NAD(+) cosubstrate specificity of a Sir2 enzyme. Mol.Cell 17 855-868 2005
    Site OTHER
    PDB Id 1yc5 Target Id PDB1YC5
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS19953, TM0490 Molecular Weight 27536.31 Da.
    Residues 246 Isoelectric Point 5.38
    Sequence mkmkefldllnesrltvtltgagistpsgipdfrgpngiykkysqnvfdidffyshpeefyrfakegifp mlqakpnlahvllakleekglieavitqnidrlhqragskkvielhgnveeyycvrcekkytvedvikk lessdvplcddcnslirpnivffgenlpqdalreaiglssraslmivlgsslvvypaaelplitvrsgg klvivnlgetpfddiatlkynmdvvefarrvmeeggis
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.40 Rfree 0.20218
    Matthews' coefficent 2.48 Rfactor 0.1854
    Waters 266 Solvent Content 50.40

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands NCA (NICOTINAMIDE) x 1
    Metals ZN (ZINC) x 1

    Jmol

     
    Google Scholar output for 1yc5

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch