.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xkr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure and Function of an Unusual Family of Protein Phosphatases; The Bacterial Chemotaxis Proteins CheC and CheX. Mol.Cell 16 563-574 2004
    Site OTHER
    PDB Id 1xkr Target Id PDB1XKR
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS19980, TM0904 Molecular Weight 22685.30 Da.
    Residues 206 Isoelectric Point 4.50
    Sequence hmkiserqkdllkeignigagnaataisyminkkveisvpnveivpiskvifiakdpeeivvgvkmpvtg diegsvllimgttvvkkileiltgrapdnllnldefsasalreignimcgtyvsaladflgfkidtlpp qlvidmisaifaeasieelednsedqivfvetllkveeeeepltsymmmipkpgylvkifermgiqe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.75 Rfree 0.239
    Matthews' coefficent 3.37 Rfactor 0.226
    Waters 184 Solvent Content 63.50

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1xkr

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch