.
The Open Protein Structure Annotation Network
PDB Keyword
.

1uyp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Three-Dimensional Structure of Invertase ({Beta}-Fructosidase) from Thermotoga Maritima Reveals a Bimodular Arrangement and an Evolutionary Relationship between Retaining and Inverting Glycosidases. J.Biol.Chem. 279 18903 2004
    Site OTHER
    PDB Id 1uyp Target Id PDB1UYP
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS18720, TM1414 Molecular Weight 49820.87 Da.
    Residues 432 Isoelectric Point 5.28
    Sequence lfkpnyhffpitgwmndpnglifwkgkyhmfyqynprkpewgnicwghavsddlvhwrhlpvalypddet hgvfsgsavekdgkmflvytyyrdpthnkgeketqcvvmsengldfvkydgnpviskppeegthafrdp kvnrsngewrmvlgsgkdekigrvllytsddlfhwkyegaifedettkeiecpdlvrigekdiliysit stnsvlfsmgelkegklnvekrglldhgtdfyaaqtffgtdrvvvigwlqswlrtglyptkregwngvm slprelyvennelkvkpvdellalrkrkvfetaksgtflldvkensyeivcefsgeielrmgneseevv itksrdelivdttrsgvsggevrkstvedeatnrirafldscsvefffndsiafsfrihpenvynilsv ksnqvklevfeleniwl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 1.90 Rfree 0.220
    Matthews' coefficent 2.2 Rfactor 0.177
    Waters 1756 Solvent Content 43

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands SO4 (SULFATE) x 14;CIT (CITRIC) x 1;GOL (GLYCEROL) x 6
    Metals NA (SODIUM) x 1

    Jmol

     
    Google Scholar output for 1uyp

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch