.
The Open Protein Structure Annotation Network
PDB Keyword
.

1usy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Regulation of the Hetero-Octameric ATP Phosphoribosyl Transferase Complex from Thermotoga Maritima by a tRNA Synthetase-Like Subunit. Mol.Microbiol. 55 675 2005
    Site OTHER
    PDB Id 1usy Target Id PDB1USY
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS20018, TM1043 Molecular Weight 31286.90 Da.
    Residues 275 Isoelectric Point 4.93
    Sequence mdfldfekvfsfyskatkkgfspffvpalekaeepagnffldrkgnlfsiredftktvlnhrkryspdsq ikvwyadfvyrysgsdlvaeyqlglekvprnslddslevleiivesaseffegpviveightgvyedll keipkdlhekvlnlidtknlaeieflshmkkidlsrvekiiedsiyrrspehlktmdlplsvredllsa ssflqekfptvsveidltlartieeycgliftiydtsssrlvaaggeytvngekgvggsiflegktc
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.52 Rfree 0.287
    Matthews' coefficent 2.44 Rfactor 0.203
    Waters 274 Solvent Content 49.2

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands HIS (PHOSPHATE) x 8;PO4 x 6
    Metals

    Jmol

     
    Google Scholar output for 1usy

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch