.
The Open Protein Structure Annotation Network
PDB Keyword
.

1up7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Nad+ and Metal-Ion Dependent Hydrolysis by Family 4 Glycosidases: Structural Insight Into Specificity for Phospho-Beta-D-Glucosides. J.Mol.Biol. 346 423 2005
    Site OTHER
    PDB Id 1up7 Target Id PDB1UP7
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS18716, TM1281 Molecular Weight 47917.63 Da.
    Residues 417 Isoelectric Point 5.92
    Sequence rhmriavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfkvlisdtfega vvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafpiveeyvdtvrktsnativn ftnpsghitefvrnyleyekfiglcnvpinfireiaemfsarledvflkyyglnhlsfiekvfvkgedv tekvfenlklklsnipdedfptwfydsvrlivnpylryylmekkmfkkisthelrarevmkiekelfek yrtaveipeeltkrggsmystaaahlirdletdegkihivntrnngsienlpddyvleipcyvrsgrvh tlsqgkgdhfalsfihavkmyerltieaylkrskklalkallshplgpdvedakdlleeileanreyvklg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.40 Rfree 0.240
    Matthews' coefficent 2.8 Rfactor 0.199
    Waters 759 Solvent Content 56.3

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands NAD (NICOTINAMIDE-ADENINE-DINUCLEOTIDE) x 8;G6P (ALPHA-D-GLUCOSE-6-PHOSPHATE) x 8;SO4 (SULFATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 1up7

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch