.
The Open Protein Structure Annotation Network
PDB Keyword
.

1tmy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structures of CheY from Thermotoga maritima do not support conventional explanations for the structural basis of enhanced thermostability. Protein Sci. 7 403-412 1998
    Site OTHER
    PDB Id 1tmy Target Id PDB1TMY
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS20024, TM0700 Molecular Weight 13216.04 Da.
    Residues 120 Isoelectric Point 7.77
    Sequence mgkrvlivddaafmrmmlkdiitkagyevageatngreavekykelkpdivtmditmpemngidaikeim kidpnakiivcsamgqqamvieaikagakdfivkpfqpsrvvealnkvsk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree
    Matthews' coefficent 2.20 Rfactor 0.1860000
    Waters 15 Solvent Content 50.00

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1tmy

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch