The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Cobalamin-independent methionine synthase (MetE): a face-to-face double barrel that evolved by gene duplication. Plos Biol. 3 e31 2005
    Site OTHER
    PDB Id 1t7l Target Id PDB1T7L
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS18724, TM1286 Molecular Weight 89289.79 Da.
    Residues 766 Isoelectric Point 5.35
    Sequence mhhhhhhgkpipnpllgldstenlyfqqidpftkayafgfpkigekrefkkaledfwkgkiteeqfeeem nklrmymvenyrknvdvipsnelsyydfvldtavmvgavperfgeyrglstyfdmarggkalemtkffn tnyhylvpeieteefyllenkpledylffkskgietapwvigpftflylskrngewirrpnqmeklles lvsvykevfeklvengckeilvnepafvcdlekahwdlilnvyrelsefpltvftyydsvsdyeacvsl pvkrlhfdfvsneenlknlekhgfpedkklvagvingrqpwkvdlrkvaslveklgasaisnscplfhl pvtlelennlpgglkeklafakekleelkmlkdflegktfdlpnvsfedfavdlqavervrnlpedsfr rekeyterdriqrerlnlplfptttigsfpqtpevrkmrskyrkgeiskeeyeafikeqikkaielqee igldvlvhgefertdmveffaeklngiattqngwvlsygsrcyrppiiygtvtrpepmtlkeityaqsl tekpvkgmltgpvtimswsyyredipereiayqialaineevkdleeagikivqidepafrekapikks kwpeyfewainafnlaanarpetqihahmcysdfneiieyihqlefdvisieasrskgeiisafenfkg wikqigvgvwdihspavpsinemreivervlrvlpkeliwinpdcglktrnwdevipslrnmvalakemrekfes
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.24
    Matthews' coefficent 2.33 Rfactor 0.206
    Waters 618 Solvent Content 47.20

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands SO4 (SULFATE) x 2;MRY (MESO-ERYTHRITOL) x 2


    Google Scholar output for 1t7l

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch