.
The Open Protein Structure Annotation Network
PDB Keyword
.

1q7m

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structures of the N-terminal modules imply large domain motions during catalysis by methionine synthase. Proc.Natl.Acad.Sci.Usa 101 3729-3736 2004
    Site OTHER
    PDB Id 1q7m Target Id PDB1Q7M
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS19964, TM0268 Molecular Weight 63546.92 Da.
    Residues 566 Isoelectric Point 5.60
    Sequence mrnrrevskllservllldgaygtefmkygyddlpeelnikapdvvlkvhrsyiesgsdviltntfgatr mklrkhgledkldpivrnavriarraageklvfgdigptgelpyplgstlfeefyenfretveimveeg vdgiifetfsdilelkaavlaarevsrdvfliahmtfdekgrsltgtdpanfaitfdeldidalgincs lgpeeilpifqelsqytdkflvvepnagkpivengktvyplkphdfavhidsyyelgvnifggccgttp ehvklfrkvlgnrkplqrkkkrifavsspsklvtfdhfvvigerinpagrkklwaemqkgneeivikea ktqvekgaevldvnfgiesqidvryvekivqtlpyvsnvplsldiqnvdlteralraypgrslfnsakv deeelemkinllkkyggtlivllmgkdvpksfeerkeyfekalkilerhdfsdrvifdpgvlplgaegk pvevlktiefisskgfnttvglsnlsfglpdrsyyntaflvlgiskglssaimnpldetlmktlnatlv ilekkelpraevk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.242
    Matthews' coefficent 2.44 Rfactor 0.198
    Waters 205 Solvent Content 49.68

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1q7m

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch