.
The Open Protein Structure Annotation Network
PDB Keyword
.

1mky

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Domain Arrangement of Der, a Switch Protein Containing Two GTPase Domains. Structure 10 1649-1658 2002
    Site OTHER
    PDB Id 1mky Target Id PDB1MKY
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS20040, TM1446 Molecular Weight 50086.43 Da.
    Residues 439 Isoelectric Point 9.22
    Sequence matvlivgrpnvgkstlfnklvkkkkaivedeegvtrdpvqdtvewygktfklvdtcgvfdnpqdiisqk mkevtlnmireadlvlfvvdgkrgitkedesladflrkstvdtilvankaenlreferevkpelyslgf gepipvsaehninldtmletiikkleekgldleskpeitdaikvaivgrpnvgkstlfnailnkeralv spipgttrdpvddevfidgrkyvfvdtaglrrksrveprtvekysnyrvvdsiekadvvvivldatqgi trqdqrmaglmerrgrasvvvfnkwdlvvhrekrydeftklfreklyfidyspliftsadkgwnidrmi damnlayasyttkvpssainsalqkvlaftnlprglkiffgvqvdikpptflffvnsiekvknpqkifl rklirdyvfpfegspiflkfkrsr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.224
    Matthews' coefficent 2.35 Rfactor 0.204
    Waters 246 Solvent Content 47.20

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 5;GDP (GUANOSINE-5'-DIPHOSPHATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 1mky

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch