The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site OTHER
    PDB Id 1lwh Target Id PDB1LWH
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS18691, TM0364 Molecular Weight 51854.51 Da.
    Residues 441 Isoelectric Point 5.58
    Sequence migyqiyvrsfrdgnldgvgdfrglknavsylkelgidfvwlmpvfssisfhgydvvdfysfkaeygser efkemieafhdsgikvvldlpihhtgflhtwfqkalkgdphyrdyyvwanketdlderrewdgekiwhp ledgrfyrglfgpfspdlnydnpqvfdemkrlvlhlldmgvdgfrfdaakhmrdtieqnvrfwkyflsd lkgiflaeiwaearmvdehgrifgymlnfdtshcikeavwkentrvliesieraviakdylpvnftsnh dmsrlasfeggfskekiklsisilftlpgvplvfygdelgmkgvyqkpntevvldpfpwnesmcvegqt fwkwpayngpfsgisveyqkrdpdsilshtlgwtrfrkenqwidrakleflckedkflvyrlyddqhsl kvfhnlsgeevvfegvkmkpyktevv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.60 Rfree 0.2780000
    Matthews' coefficent 4.00 Rfactor 0.2240000
    Waters 174 Solvent Content 69.25

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Metals CA (CALCIUM) x 2


    Google Scholar output for 1lwh

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch