.
The Open Protein Structure Annotation Network
PDB Keyword
.

1in4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure and mechanism of the RuvB Holliday junction branch migration motor. J.Mol.Biol. 311 297-310 2001
    Site OTHER
    PDB Id 1in4 Target Id PDB1IN4
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26107, TM1730 Molecular Weight 37154.11 Da.
    Residues 334 Isoelectric Point 6.07
    Sequence msefltpertvydsgvqflrpksldefigqenvkkklslaleaakmrgevldhvllagppglgkttlahi iaselqtnihvtsgpvlvkqgdmaailtslergdvlfideihrlnkaveellysaiedfqidimigkgp saksiridiqpftlvgattrsgllssplrsrfgiileldfytvkelkeiikraaslmdveiedaaaemi akrsrgtpriairltkrvrdmltvvkadrintdivlktmevlniddegldefdrkilktiieiyrggpv glnalaaslgveadtlsevyepyllqagflartprgrivtekaykhlkyevpenrlf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.253
    Matthews' coefficent 2.39 Rfactor 0.234
    Waters 218 Solvent Content 48.60

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands ACT (ACETATE) x 2;ADP (ADENOSINE-5'-DIPHOSPHATE) x 1;HEZ (HEXANE-1,6-DIOL) x 2
    Metals CO (COBALT) x 1

    Jmol

     
    Google Scholar output for 1in4

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch