.
The Open Protein Structure Annotation Network
PDB Keyword
.

1hdg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of holo-glyceraldehyde-3-phosphate dehydrogenase from the hyperthermophilic bacterium Thermotoga maritima at 2.5 A resolution. J.Mol.Biol. 246 511-521 1995
    Site OTHER
    PDB Id 1hdg Target Id PDB1HDG
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS19959, TM0688 Molecular Weight 36291.89 Da.
    Residues 332 Isoelectric Point 6.23
    Sequence arvaingfgrigrlvyriiyerknpdievvaindltdtktlahllkydsvhkkfpgkveytenslivdgk eikvfaepdpsklpwkdlgvdfviestgvfrnrekaelhlqagakkviitapakgeditvvigcnedql kpehtiiscascttnsiapivkvlhekfgivsgmlttvhsytndqrvldlphkdlrraraaavniiptt tgaakavalvvpevkgkldgmairvptpdgsitdltvlvekettveevnavmkeategrlkgiigynde pivssdiigttfsgifdatitnviggklvkvaswydneygysnrvvdtlelllkm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree
    Matthews' coefficent 2.69 Rfactor 0.1660000
    Waters 206 Solvent Content 54.33

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands SO4 (SULFATE) x 4;NAD (NICOTINAMIDE-ADENINE-DINUCLEOTIDE) x 2
    Metals

    Jmol

     
    Google Scholar output for 1hdg

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch