The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Molecular Architecture of Smc Proteins and the Yeast Cohesin Complex. Mol.Cell 9 773 2002
    Site OTHER
    PDB Id 1gxl Target Id PDB1GXL
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS20032, TM1182 Molecular Weight 24225.40 Da.
    Residues 213 Isoelectric Point 5.39
    Sequence dakekrlreiqfekemierdmreyrgfsravravfeekerfpglvdvvsnlievdekyslavsvllggta qnivvrnvdtakaiveflkqneagrvtilpldlidgsfnrisglenergfvgyavdlvkfpsdlevlgg flfgnsvvvetlddairmkkkyrlntriatldgelisgrgaitggreerssnvferriklkhleqemee terqi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 3.00 Rfree 0.3010
    Matthews' coefficent Rfactor 0.2524
    Waters Solvent Content 60

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information


    Google Scholar output for 1gxl

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch