.
The Open Protein Structure Annotation Network
PDB Keyword
.

1gm5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural Analysis of DNA Replication Fork Reversal by Recg. Cell(Cambridge,Mass.) 107 79 2001
    Site OTHER
    PDB Id 1gm5 Target Id PDB1GM5
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS20026, TM0205 Molecular Weight 89926.62 Da.
    Residues 780 Isoelectric Point 6.51
    Sequence mlcsryftsslflwgealptlleeflnevekmlknqvntrrihqllkelddpllenkdleeklqafldyv keipnlpearkryriqkslemieklrswflidylecsgeevdlstdiqyakgvgpnrkkklkklgietl rdlleffprdyedrrkifklndllpgekvttqgkivsvetkkfqnmniltavlsdglvhvplkwfnqdy lqtylkqltgkevfvtgtvksnaytgqyeihnaevtpkegeyvrrilpiyrltsgisqkqmrkifeeni pslccslketlperilekrkllgvkdayygmhfpktfyhlekarerlayeelfvlqlafqkirkerekh ggipkkiegklaeefikslpfkltnaqkrahqeirndmisekpmnrllqgdvgsgktvvaqlaildnye agfqtafmvptsilaiqhyrrtvesfskfnihvalligattpsekekiksglrngqidvvigthaliqe dvhfknlglviideqhrfgvkqrealmnkgkmvdtlvmsatpiprsmalafygdldvtvidemppgrke vqtmlvpmdrvnevyefvrqevmrggqafivyplieesdklnvksavemyeylskevfpefklglmhgr lsqeekdrvmlefaegrydilvsttvievgidvpranvmvienperfglaqlhqlrgrvgrggqeaycf lvvgdvgeeamerlrfftlntdgfkiaeydlktrgpgeffgvkqhglsgfkvadlyrdlkllewaredv qeidvegielpeeiklievg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 3.24 Rfree 0.328
    Matthews' coefficent Rfactor 0.272
    Waters Solvent Content

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands ADP (ADENOSINE-5'-DIPHOSPHATE) x 1
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 1gm5

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch