.
The Open Protein Structure Annotation Network
PDB Keyword
.

1gju

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of Thermotoga Maritima Maltosyltransferase and its Implications for the Molecular Basis of the Novel Transfer Specificity. J.Mol.Biol. 312 119 2001
    Site OTHER
    PDB Id 1gju Target Id PDB1GJU
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS20038, TM0767 Molecular Weight 73701.96 Da.
    Residues 637 Isoelectric Point 5.53
    Sequence mllreinryckekatgkriyavpklwipgffkkfdeksgrcfvdpyelgaeitdwilnqsrewdysqpls flkgektpdwikrsvvygslprttaaynhkgsgyyeendvlgfreagtffkmmlllpfvkslgadaiyl lpvsrmsdlfkkgdapspysvknpmelderyhdpllepfkvdeefkafveachilgirvildfiprtaa rdsdlirehpdwfywikveeladytppraeelpfkvpdedeleiiynkenvkrhlkkftlppnlidpqk wekikreegnilelivkefgiitppgfsdlindpqptwddvtflrlyldhpeaskrfldpnqppyvlyd vikaskfpgkepnrelweylagviphyqkkygidgarldmghalpkelldliiknvkeydpafvmiaee ldmekdkaskeagydvilgsswyfagrveeigklpdiaeelvlpflasvetpdtpriatrkyaskmkkl apfvtyflpnsipyvntgqeigekqpmnlgldtdpnlrkvlsptdeffgklaffdhyvlhwdspdrgvl nfikklikvrhefldfvlngkfenlttkdlvmysyekngqkiviaanvgkepkeitggrvwngkwsdee kvvlkplefalvvqe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.4 Rfree 0.263
    Matthews' coefficent 4.0 Rfactor 0.208
    Waters 259 Solvent Content 66

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 3
    Metals

    Jmol

     
    Google Scholar output for 1gju

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch