The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the ribosome at 5.5 A resolution. Science 292 883-896 2001
    Site OTHER
    PDB Id 1giy Target Id PDB1GIY
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS20014, TM0454 Molecular Weight 24693.12 Da.
    Residues 228 Isoelectric Point 9.42
    Sequence pkhgkryrallekvdpnkiytideaahlvkelatakfdetvevhaklgidprrsdqnvrgtvslphglgk qvrvlaiakgekikeaeeagadyvggeeiiqkildgwmdfdavvatpdvmgavgsklgrilgprgllpn pkagtvgfnigeiireikagriefrndktgaihapvgkasfppekladnirafiraleahkpegakgtf lrsvyvtttmgpsvrinphs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 5.50 Rfree
    Matthews' coefficent Rfactor
    Waters Solvent Content

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information


    Google Scholar output for 1giy

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch