.
The Open Protein Structure Annotation Network
PDB Keyword
.

1g6p

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of the cold-shock protein from the hyperthermophilic bacterium Thermotoga maritima. Eur.J.Biochem. 268 2527-2539 2001
    Site OTHER
    PDB Id 1g6p Target Id PDB1G6P
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS19994, TM1683 Molecular Weight 7472.26 Da.
    Residues 66 Isoelectric Point 6.73
    Sequence mrgkvkwfdskkgygfitkdeggdvfvhwsaiemegfktlkegqvvefeiqegkkgpqaahvkvve
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1g6p

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch