.
The Open Protein Structure Annotation Network
PDB Keyword
.

1e4f

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Cell Division Protein Ftsa from Thermotoga Maritima. Embo J. 19 5300 2000
    Site OTHER
    PDB Id 1e4f Target Id PDB1E4F
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS19986, TM0835 Molecular Weight 47013.34 Da.
    Residues 419 Isoelectric Point 5.45
    Sequence midlsktvfytsidigsryikglvlgkrdqewealafssvksrgldegeikdaiafkesvntllkeleeq lqkslrsdfvisfssvsferedtvierdfgeekrsitldilsemqsealeklkengktplhifskryll dderivfnpldmkaskiaieytsivvplkvyemfynflqdtvkspfqlksslvstaegvlttpekdrgv vvvnlgynftgliaykngvpikisyvpvgmkhvikdvsavldtsfeeserliithgnavyndlkeeeiq yrgldgntiktttakklsviiharlreimskskkffreveakiveegeigipggvvltgggakiprine latevfkspvrtgcyansdrpsiinadevandpsfaaafgnvfavsenpyeetpvksenplkkifrlfkelme
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.249
    Matthews' coefficent Rfactor 0.221
    Waters 141 Solvent Content 42

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1e4f

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch