The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Flexibility, conformational diversity and two dimerization modes in complexes of ribosomal protein L12. EMBO J. 19 174-186 2000
    Site OTHER
    PDB Id 1dd3 Target Id PDB1DD3
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS19976, TM0457 Molecular Weight 13456.78 Da.
    Residues 128 Isoelectric Point 4.80
    Sequence mtideiieaiekltvselaelvkkledkfgvtaaapvavaaapvagaaagaaqeektefdvvlksfgqnk iqvikvvreitglglkeakdlvekagspdaviksgvskeeaeeikkkleeagaevelk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.235
    Matthews' coefficent 0.40 Rfactor 0.226
    Waters 247 Solvent Content 41.95

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information


    Google Scholar output for 1dd3

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch