.
The Open Protein Structure Annotation Network
PDB Keyword
.

1cz3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of dihydrofolate reductase from Thermotoga maritima: molecular features of thermostability. J.Mol.Biol. 297 659-672 2000
    Site OTHER
    PDB Id 1cz3 Target Id PDB1CZ3
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS18728, TM1641 Molecular Weight 19235.33 Da.
    Residues 168 Isoelectric Point 9.33
    Sequence akvifvlamdvsgkiassveswssfedrknfrkitteignvvmgritfeeigrplperlnvvltrrpkts nnpslvffngspadvvkflegkgyervaviggktvfteflreklvdelfvtvepyvfgkgipffdefeg yfplkllemrrlnergtlflkysvekshr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.2550000
    Matthews' coefficent 2.26 Rfactor 0.2030000
    Waters 204 Solvent Content 45.67

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 1cz3

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch