The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of CheA, a signal-transducing histidine kinase. Cell(Cambridge,Mass.) 96 131-141 1999
    Site OTHER
    PDB Id 1b3q Target Id PDB1B3Q
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS20008, TM0702 Molecular Weight 42405.13 Da.
    Residues 379 Isoelectric Point 5.30
    Sequence sqtvrvdiekldnlmdlmgelviarsriletlkkynikeldeslshlsritldlqnvvmkirmvpisfvf nrfprmvrdlakkmnkevnfimrgedteldrtfveeigepllhllrnaidhgiepkeeriakgkppigt lilsarhegnnvvieveddgrgidkekiirkaiekglideskaatlsdqeilnflfvpgfstkekvsev sgrgvgmdvvknvveslngsmgiesekdkgtkvtirlpltlaiicallvkvnnlvyaipianidtilsi skediqrvqdrdvivirgevipvyrlwevlqiehkeeleemeavivrvgnrkygivvddllgqddivik slgkvfsevkefsgaailgdgsialiinvsgiv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.60 Rfree 0.2850000
    Matthews' coefficent 3.50 Rfactor 0.2130000
    Waters 187 Solvent Content 65.00

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Metals HG (MERCURY) x 2


    Google Scholar output for 1b3q

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch