The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of glutamate dehydrogenase from the hyperthermophilic eubacterium Thermotoga maritima at 3.0 A resolution. J.Mol.Biol. 267 916-932 1997
    Site OTHER
    PDB Id 1b26 Target Id PDB1B26
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS18710, TM1015 Molecular Weight 45800.23 Da.
    Residues 416 Isoelectric Point 5.84
    Sequence mpekslyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqhnvargpakg giryhpdvtldevkalafwmtwktavmnlpfgggkggvrvdpkklsrnelerlsrrffseiqviigpyn dipapdvntnadviawymdtysmnvghtvlgivtgkpvelggskgreeatgrgvkvcaglamdvlgidp kkatvavqgfgnvgqfaallisqelgskvvavsdsrggiynpegfdveelirykkehgtvvtypkgeri tneelleldvdilvpaalegaihagnaerikakavvegangpttpeadeilsrrgilvvpdilanaggv tvsyfewvqdlqsffwdldqvrnalekmmkgafndvmkvkekynvdmrtaayilaidrvayatkkrgiyp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 3.00 Rfree 0.2950000
    Matthews' coefficent 3.10 Rfactor 0.2250000
    Waters Solvent Content 60.40

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information


    Google Scholar output for 1b26

    Protein Summary


    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch