.
The Open Protein Structure Annotation Network
PDB Keyword
.

1a0e

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structures of Class II Xylose Isomerases from Two Thermophiles and a Hyperthermophile. To be Published
    Site OTHER
    PDB Id 1a0e Target Id PDB1A0E
    Molecular Characteristics
    Source Thermotoga neapolitana
    Alias Ids TPS18693, TM1667 Molecular Weight 50759.11 Da.
    Residues 443 Isoelectric Point 5.47
    Sequence aeffpeipkvqfegkestnplafkfydpeeiidgkplkdhlkfsvafwhtfvnegrdpfgdptadrpwnr ytdpmdkafarvdalfefceklnieyfcfhdrdiapegktlretnkildkvverikermkdsnvkllwg tanlfshprymhgaattcsadvfayaaaqvkkaleitkelggegyvfwggregyetllntdlgfelenl arflrmavdyakrigftgqfliepkpkeptkhqydfdvatayaflkshgldeyfkfnieanhatlaght fqhelrmarilgklgsidanqgdlllgwdtdqfptnvydttlamyevikaggftkgglnfdakvrrasy kvedlfighiagmdtfalgfkvayklvkdgvldkfieekyrsfregigrdivegkvdfekleeyiidke tielpsgkqeyleslinsyivktilelr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.70 Rfree 0.2030000
    Matthews' coefficent 2.40 Rfactor 0.1800000
    Waters 256 Solvent Content 50.00

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals CO (COBALT) x 6

    Jmol

     
    Google Scholar output for 1a0e

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch