.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ooq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title CRYSTAL STRUCTURE OF amidohydrolase from Thermotoga maritima MSB8. To be Published
    Site NYSGXRC
    PDB Id 3ooq Target Id NYSGXRC-9512b
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS32651,15644470, PF01979 Molecular Weight 42541.19 Da.
    Residues 386 Isoelectric Point 6.30
    Sequence msvkilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkflfpgfvdahshiglfee gvgyyysdgneatdpvtphvkaldgfnpqdpaieralaggvtsvmivpgsanpvggqgsvikfrsiive ecivkdpaglkmafgenpkrvygerkqtpstrmgtagvirdyftkvknymkkkelaqkegkeftetdlk mevgemvlrkkiparmhahraddiltairiaeefgfnlviehgteaykiskvlaekkipvvvgplltfr tklelkdltmetiakllkdgvlialmcdhpviplefatvqaatamrygakeedllkiltvnpakilgle drigsiepgkdadlvvwsghpfdmksvvervyidgvevfrr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 10
    Resolution (Å) 2.06 Rfree 0.2130
    Matthews' coefficent 2.40 Rfactor 0.1672
    Waters 1772 Solvent Content 48.65

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands GOL (GLYCEROL) x 5
    Metals

    Jmol

     
    Google Scholar output for 3ooq

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch