.
The Open Protein Structure Annotation Network
PDB Keyword
.

3nek

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural underpinnings of nitrogen regulation by the prototypical nitrogen-responsive transcriptional factor NrpR. To be Published
    Site NYSGXRC
    PDB Id 3nek Target Id NYSGXRC-10196a
    Molecular Characteristics
    Source Methanococcus jannaschii
    Alias Ids TPS7995,Q57623, PF01995 Molecular Weight 61159.75 Da.
    Residues 542 Isoelectric Point 5.55
    Sequence viimadldrklieildilskskepvgakiiakelnkrgykigeravryhlklldgmkltkkvgyagrvi tergleelekanisyrlgsiysnilektisanyrfgyvvinrcqvyadfndvlkiiksvyesglavgdr vgiidrekfveintlcslnfdnillqngifplhvcagvvkyedgkpvefkeiidykstsidplrafiek ketdvmgiiengegylpanfryfgveflerfetileidelkciisygtenvlgldvgddkvgvaliggl tpiapfvennycveicpmssivrleslhklkknprdivtkkaniriktalskmfnamakvtydideadg dvivntafidkkyldeafdilkeaykkglgisdrfgiveendrikiqticavtldgiflrnsvplipky ggileitedkerfidiigydgssldphevffnfvdcektflagfrevhrvarekleevlkklnwngika igepnnelygigvnkdmcgvvtmgginplvllkeneipielkamhevvrfsdlksykei
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.277
    Matthews' coefficent 1.98 Rfactor 0.246
    Waters 14 Solvent Content 37.78

    Ligand Information
    Ligands GOL (GLYCEROL) x 3
    Metals

    Jmol

     
    Google Scholar output for 3nek
    1. Structural Underpinnings of Nitrogen Regulation by the Prototypical Nitrogen-Responsive Transcriptional Factor NrpR
    G Wisedchaisri, DM Dranow, TJ Lie, JB Bonanno - Structure, 2010 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch