.
The Open Protein Structure Annotation Network
PDB Keyword
.

3me5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title CRYSTAL STRUCTURE OF putative DNA cytosine methylase from Shigella flexneri 2a str. 301. To be Published
    Site NYSGXRC
    PDB Id 3me5 Target Id NYSGXRC-13594a
    Related PDB Ids 3lx6 
    Molecular Characteristics
    Source Shigella flexneri
    Alias Ids TPS33306,AAP17376.1, PF00145 Molecular Weight 53550.14 Da.
    Residues 472 Isoelectric Point 8.57
    Sequence mqenisvtdsystgnaaqamlekllqiydvkmlvaqlngvgenhwsaailkralandsawhrlsekefa hlqtllpkppehhphyafrfidlfagiggirrgfesiggqcvftsewnkhavrtykanhycdpathhfn edirditlshqegvsdeaaaehirqhipehdvllagfpcqpfslagvskknslgrahgfacdtqgtlff dvvriidarrpamfvlenvknlkshdkgktfriimqtldelgydvadaedngpddpkiidgkhflpqhr erivlvgfrrdlnlkadftlrdisecfpaqrvtlaqlldpmveakyiltpvlwkylyryakkhqargng fgygmvypnnpqsvtrtlsaryykdgaeilidrgwdmatgekdfddplnqqhrprrltprecarlmgfe apgeakfripvsdtqayrqfgnsvvvpvfaavakllepkikqavalrqqeaqhgrrsr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.75 Rfree 0.261
    Matthews' coefficent 2.20 Rfactor 0.220
    Waters 278 Solvent Content 44.11

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3me5

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch