.
The Open Protein Structure Annotation Network
PDB Keyword
.

3mae

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title CRYSTAL STRUCTURE OF A CATALYTIC DOMAIN OF DIHYDROLIPAMIDE ACETYLTRANSFERASE FROM LISTERIA MONOCYTOGENES 4b F2365. To be Published
    Site NYSGXRC
    PDB Id 3mae Target Id NYSGXRC-13644a
    Molecular Characteristics
    Source Listeria monocytogenes
    Alias Ids TPS33309,PF00198, AAT04166.1 Molecular Weight 44853.86 Da.
    Residues 416 Isoelectric Point 5.24
    Sequence vavekitmpklgesvtegtisswlvkpgdtvekydaiaevltdkvtaeipssfsgtikeilaeedetle vgevictietadagssepvaeveetetkapekqetkqvkladapasgrfspavlriagennidlstveg tgkggritrkdllqviengpvakreemksapqekaamptppvrsaagdkeipingvrkaiakhmsvskq eiphawmmvevdatglvryrnavkdsfkkeegysltyfaffikavaqalkefpqlnstwagdkiiehan inisiaiaagdllyvpviknadeksikgiareiselagkarngklsqadmeggtftvnstgsfgsvqsm giinhpqaailqvesivkrpviiddmiavrdmvnlclsidhrildgllagkflqaikanvekiskentaly
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.50 Rfree 0.23362
    Matthews' coefficent 3.74 Rfactor 0.19192
    Waters 68 Solvent Content 67.11

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 11;GOL (GLYCEROL) x 8
    Metals CL (CHLORIDE) x 9

    Jmol

     
    Google Scholar output for 3mae

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch