.
The Open Protein Structure Annotation Network
PDB Keyword
.

3m9l

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Had Family Hydrolase from Pseudomonas Fluorescens Pf-5. To be Published
    Site NYSGXRC
    PDB Id 3m9l Target Id NYSGXRC-22261a
    Molecular Characteristics
    Source Pseudomonas fluorescens
    Alias Ids TPS33360,70732705, PF00702 Molecular Weight 21539.17 Da.
    Residues 197 Isoelectric Point 4.93
    Sequence mslseikhwvfdmdgtltiavhdfaairealsipaeddilthlaalpadesaakhawlleherdlaqgs rpapgavelvrelagrgyrlgiltrnarelahvtleaigladcfaeadvlgrdeappkphpggllklae awdvspsrmvmvgdyrfdldcgraagtrtvlvnlpdnpwpeltdwhardcaqlrdllsa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.21104
    Matthews' coefficent 3.50 Rfactor 0.18780
    Waters 302 Solvent Content 64.89

    Ligand Information
    Ligands GOL (GLYCEROL) x 2
    Metals

    Jmol

     
    Google Scholar output for 3m9l

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch