.
The Open Protein Structure Annotation Network
PDB Keyword
.

3m2t

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of dehydrogenase from Chromobacterium violaceum. To be Published
    Site NYSGXRC
    PDB Id 3m2t Target Id NYSGXRC-11155o
    Molecular Characteristics
    Source Chromobacterium violaceum
    Alias Ids TPS33371,3.40.50.720, NP_901077.1 Molecular Weight 38880.32 Da.
    Residues 350 Isoelectric Point 5.74
    Sequence mslikvglvgigaqmqenllpsllqmqdirivaacdsdlerarrvhrfisdipvldnvpamlnqvplda vvmagppqlhfemgllamskgvnvfvekppcatleeletlidaarrsdvvsgvgmnfkfarpvrqlrem tqvdefgetlhiqlnhyankpraplwgldstlrsfllaqaihtidlaitfgdgelrrvqssvqrhddal ivkadmafssgatasllagtsfpyfefdmklvsssstlveldnlwnitlhepehatrptgaakrwrgaw qpgpldsgyersgyhgelhqffqairehrrfeadfasllptyrvieeicsadavaqglqnahsrirtgi eslsl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.2305
    Matthews' coefficent 2.81 Rfactor 0.1827
    Waters 239 Solvent Content 56.23

    Ligand Information
    Ligands NAD (NICOTINAMIDE-ADENINE-DINUCLEOTIDE) x 2;SO4 (SULFATE) x 3
    Metals

    Jmol

     
    Google Scholar output for 3m2t

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch