.
The Open Protein Structure Annotation Network
PDB Keyword
.

3m1y

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a Phosphoserine phosphatase (SerB) from Helicobacter pylori. To be Published
    Site NYSGXRC
    PDB Id 3m1y Target Id NYSGXRC-22167a
    Molecular Characteristics
    Source Helicobacter pylori
    Alias Ids TPS33358,PF00702, 15645276 Molecular Weight 22957.53 Da.
    Residues 207 Isoelectric Point 6.53
    Sequence vqklavfdfdstlvnaetieslarawgvfdevktitlkamngetdfhkslilrvsklknmplklakevc eslplfegalelvsalkeknykvvcfsggfdlatnhyrdllhldaafsntlivendalnglvtghmmfs hskgemllvlqrllnisktntlvvgdgandlsmfkhahikiafnakevlkqhathcinepdlalikpli
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.40 Rfree 0.271
    Matthews' coefficent 2.28 Rfactor 0.229
    Waters 102 Solvent Content 46.01

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 5;MG (MAGNESIUM) x 5

    Jmol

     
    Google Scholar output for 3m1y
    1. The Structural Domains of Pseudomonas aeruginosa Phosphorylcholine Phosphatase Cooperate in Substrate Hydrolysis: 3D structure andenzymatic
    L Infantes, LH Otero, PR Beassoni, C Boetsch - Journal of Molecular , 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch