.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lyp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of stringent starvation protein A homolog from Pseudomonas fluorescens. To be published
    Site NYSGXRC
    PDB Id 3lyp Target Id NYSGXRC-21019c
    Molecular Characteristics
    Source Pseudomonas fluorescens
    Alias Ids TPS33356,70732400, PF02798 Molecular Weight 23400.77 Da.
    Residues 205 Isoelectric Point 6.12
    Sequence mgvtnrlacysdpadhyshrvrivlaekgvsaeiisveagrqppklievnpygslptlvdrdlalwest vvmeylderyphppllpvypvaransrllihriqrdwcgqvdlildprtkeaarvqarkelresltgvs plfadkpfflseeqslvdccllpilwrlpvlgielprqakplldymerqfareafqaslsgverdmr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.212
    Matthews' coefficent 2.24 Rfactor 0.183
    Waters 217 Solvent Content 45.02

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3lyp
    1. Enzymology and medicinal chemistry of N5-carboxyaminoimidazole ribonucleotide synthetase: A novel antibacterial target
    H Paritala - 2011 - gradworks.umi.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch