.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lyk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of stringent starvation protein A homolog from Haemophilus influenzae. To be published
    Site NYSGXRC
    PDB Id 3lyk Target Id NYSGXRC-21019a
    Molecular Characteristics
    Source Haemophilus influenzae
    Alias Ids TPS33355,PF02798, 16273348 Molecular Weight 24288.87 Da.
    Residues 212 Isoelectric Point 5.22
    Sequence mssasskrsvmtlfsnkddiychqvkivlaekgvlyenaevdlqalpedlmelnpygtvptlvdrdlvl fnsriimeylderfphpplmqvypvsrakdrllmlrieqdwyptlakaengtekektsalkqlkeellg iapifqqmpyfmneefglvdcyvapllwklkhlgveftgtgskaikaymervftrdsflqsvgeaapkn lmddk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.237
    Matthews' coefficent 3.50 Rfactor 0.202
    Waters 124 Solvent Content 64.90

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3lyk
    1. A conserved interdomain interaction is a determinant of folding cooperativity in the GST fold
    N Parbhoo, SH Stoychev, S Fanucchi, I Achilonu - Biochemistry, 2011 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch