.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lyb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of putative endoribonuclease(KP1_3112) from Klebsiella pneumoniae. To be published
    Site NYSGXRC
    PDB Id 3lyb Target Id NYSGXRC-11275b
    Molecular Characteristics
    Source Klebsiella pneumoniae
    Alias Ids TPS33399,ABR77465.1, PF01042, 3.30.1330.40 Molecular Weight 17513.07 Da.
    Residues 159 Isoelectric Point 5.13
    Sequence msleagagaplaryaawrragdfiflsgiipvnpltgtivngfqdvpepvrellgatgefstdakqgpi laqswyvlesirrtvasaggqmsdviklvqyfrnldhfpyysrvrklfypdqppvstvvqvsemlpdat vlieveatvwlppsfnseapr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.66 Rfree 0.248
    Matthews' coefficent 2.61 Rfactor 0.193
    Waters 28 Solvent Content 52.90

    Ligand Information
    Ligands
    Metals CA (CALCIUM) x 4

    Jmol

     
    Google Scholar output for 3lyb

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch