.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lxt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Glutathione S Transferase from Pseudomonas fluorescens. To be Published
    Site NYSGXRC
    PDB Id 3lxt Target Id NYSGXRC-21039a
    Related PDB Ids 3m0f 
    Molecular Characteristics
    Source Pseudomonas fluorescens
    Alias Ids TPS33357,70729948, PF02798 Molecular Weight 22333.69 Da.
    Residues 203 Isoelectric Point 5.95
    Sequence mkligmldspyvrrvaislkslglpfehhslsvfstfeqfkainpvvkaptlvceggevlmdssliidy letlagpqrslmptalpqrlrelrlvglalaaceksvqivyernlrpaekqhgpwlervggqlqaayge leqelqkqplprdgslgqagislavawsfsqmmvadqfnpgqfpavrgfaeyaeqlpvflatpat
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.76 Rfree 0.226
    Matthews' coefficent 2.35 Rfactor 0.199
    Waters 820 Solvent Content 47.73

    Ligand Information
    Ligands GOL (GLYCEROL) x 2
    Metals CL (CHLORIDE) x 7

    Jmol

     
    Google Scholar output for 3lxt

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch