.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lvs

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Isoprenyl Diphosphate Synthase from Rhodobacter Capsulatus Sb1003. To be Published
    Site NYSGXRC
    PDB Id 3lvs Target Id NYSGXRC-20032c
    Related PDB Ids 3m0g 
    Molecular Characteristics
    Source Rhodobacter capsulatus
    Alias Ids TPS33349,ADE44162, PF00348 Molecular Weight 29754.04 Da.
    Residues 288 Isoelectric Point 4.77
    Sequence mfserlkeiqdavetamaaaigrlpagdlrdamayaaqggkrlraflaiesaaihgismaqampaalav ealhayslvhddmpcmdnddlrrglptvhkkwddatavlagdalqtlafelctdpvlgsaenrvalvaa laqasgaegmvygqaldiaaetaavpltldeiirlqagktgalisfaaqagailagadrgpltayatal glafqiaddildvegneeaagkrlgkdaeahkatfvsllglagaksraadlvaeaeaalapygeaastl racaryvierdk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.15 Rfree 0.25041
    Matthews' coefficent 2.62 Rfactor 0.21653
    Waters 125 Solvent Content 53.12

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 4;GOL (GLYCEROL) x 2
    Metals

    Jmol

     
    Google Scholar output for 3lvs
    1. Molecular Interaction Fields (MIFs) to Predict Lipophilicity and ADME Profile of Antitumor Pt (II) Complexes
    G Caron, M Ravera, G Ermondi - Pharmaceutical research, 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch