.
The Open Protein Structure Annotation Network
PDB Keyword
.

3luf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of probable two-component system response regulator/GGDEF domain protein. To be published
    Site NYSGXRC
    PDB Id 3luf Target Id NYSGXRC-11202f
    Related PDB Ids 3mf4 
    Molecular Characteristics
    Source Aeromonas hydrophila
    Alias Ids TPS33379,YP_856393.1, PF00990, 3.30.70.270 Molecular Weight 47495.92 Da.
    Residues 415 Isoelectric Point 6.14
    Sequence mkqkilivedsltirrmliqaiaqqtgleidafdtlegarhcrgeeyvvalvdltlpdapsgeavkvll erglpvviltadiseekraawleagvldyvmkdsrhslqyavslvhrlylnqrievlvvddsrtsrhrt maqlrkqllqvheasharealaqleqnpairlvlvdyympeidgislvrmlreryskqqlaiigisvsd krglsarylkqgandflnqpfepeelqcrvshnlealeqfnsiqesanrdyltglynrrywfnegqkwf eehqrqetplalcvldvdhfkqvndhwghaigdqllchltrlltqffpdamiarfggeefalmvphctv pvllkrleglrqqmrqqplsretplfvrasfgvikvgrgsmdealseadrllyqakntgrdkivsqdssa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.76 Rfree 0.226
    Matthews' coefficent 2.01 Rfactor 0.187
    Waters 169 Solvent Content 38.90

    Ligand Information
    Ligands DMS (DIMETHYL) x 3
    Metals MG (MAGNESIUM) x 4

    Jmol

     
    Google Scholar output for 3luf

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch