.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lua

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a Signal receiver domain of Two component Signal Transduction (Histidine Kinase) from Clostridium thermocellum. To be Published
    Site NYSGXRC
    PDB Id 3lua Target Id NYSGXRC-11201g
    Molecular Characteristics
    Source Clostridium thermocellum
    Alias Ids TPS33372,ABN54281.1, 3.30.70.270, PF00072 Molecular Weight 35112.42 Da.
    Residues 308 Isoelectric Point 6.78
    Sequence mdgtvllidyfeyerektkiifdnigeydfievenlkkfysifkdldsitliimdiafpvekeglevls airnnsrtantpviiatksdnpgyrhaalkfkvsdyilkpyptkrlensvrsvlkicqrfryefdsahv ismsiedyiskefkvasragqslsvilmapvglekepseqstqisselqdqiqnlaiekvklslrstdt ailnanrdilvilpftnaagaqkvlqkiqdnvreglkslninyddyyyavsvtfpndgktfqslmekav kkvedkimlekitsigvnildnarnsykkfnk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.267
    Matthews' coefficent 2.64 Rfactor 0.234
    Waters 53 Solvent Content 53.33

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3lua

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch