.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lte

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title CRYSTAL STRUCTURE OF RESPONSE REGULATOR SIGNAL RECEIVER DOMAIN FROM Bermanella marisrubri RED65. To be Published
    Site NYSGXRC
    PDB Id 3lte Target Id NYSGXRC-11009l
    Molecular Characteristics
    Source Oceanobacter sp.
    Alias Ids TPS33362,Q1N036_9GAMM, 3.40.50.2300, PF00072 Molecular Weight 20741.71 Da.
    Residues 185 Isoelectric Point 5.95
    Sequence msettyttgdvaklvgvnfrtvirwiqrgelkgyklpgrgdhrviqsdlltfmhengipvpselkqskr ilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsmpkldgldvirslrqnkv anqpkilvvsgldkaklqqavtegaddylekpfdndalldrihdlvn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 24
    Resolution (Å) 2.00 Rfree 0.28157
    Matthews' coefficent 2.58 Rfactor 0.23869
    Waters 660 Solvent Content 52.31

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 2;GOL (GLYCEROL) x 1
    Metals

    Jmol

     
    Google Scholar output for 3lte

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch