.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lsn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative geranyltranstransferase from Pseudomonas fluorescens PF-5 complexed with magnesium. To be Published
    Site NYSGXRC
    PDB Id 3lsn Target Id NYSGXRC-20027b
    Related PDB Ids 3lji 
    Molecular Characteristics
    Source Pseudomonas fluorescens
    Alias Ids TPS31608,70732810, PF00348 Molecular Weight 31394.86 Da.
    Residues 295 Isoelectric Point 5.30
    Sequence mitayqassqarvdaamhtlftapspelarlyeamrysvmnggkrvrpllayaacealggkpeqangaa cavelihayslvhddlpamddddlrrgqptthkafdeacailagdglqslafsalldpalsdasaeirl rmvttlaqaagpagmvggqaidlgsvglkldqqaleymhrhktgalieasvilgalasgraekgelkal qtyaqaiglafqvqddildvesdtatlgkrqgadiardkptypallglaaakeyalelrdqalhalrpf daaaeplrelaryiverrs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.35 Rfree 0.201
    Matthews' coefficent 2.00 Rfactor 0.179
    Waters 256 Solvent Content 38.45

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 3

    Jmol

     
    Google Scholar output for 3lsn

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch