.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lq1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Sephchc Synthase from Listeria Monocytogenes. To be Published
    Site NYSGXRC
    PDB Id 3lq1 Target Id NYSGXRC-13526a
    Molecular Characteristics
    Source Listeria monocytogenes
    Alias Ids TPS33297,AAT04472.1, PF02776 Molecular Weight 64576.85 Da.
    Residues 580 Isoelectric Point 5.45
    Sequence mtnheqvltdylaafieelvqagvkeaiispgsrstplalmmaehpilkiyvdvdersagffalglaka skrpvvllctsgtaaanyfpavaeanlsqiplivltadrphelrnvgapqamdqlhlygshvkdftdma lpenseemlryakwhgsravdiamktprgpvhlnfplreplvpilepspftatgkkhhhvhiyythevl ddssiqkmvtectgkkgvfvvgpidkkeleqpmvdlakklgwpiladplsglrsygaldevvidqydaf lkeaeiidkltpevvirfgsmpvskplknwleqlsdirfyvvdpgaawkdpikavtdmihcderflldi mqqnmpddakdaawlngwtsynkvareivlaemanttileegkivaelrrllpdkaglfignsmpirdv dtyfsqidkkikmlanrgangidgvvssalgasvvfqpmflligdlsfyhdmngllmakkykmnltivi vnndgggifsflpqanepkyfeslfgtsteldfrfaaafydadyheaksvdeleeaidkasyhkgldii evktnrhenkanhqalwvkiadalkald
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.60 Rfree 0.26460
    Matthews' coefficent 2.51 Rfactor 0.22192
    Waters 54 Solvent Content 50.98

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3lq1

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch