.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lom

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title CRYSTAL STRUCTURE OF GERANYLTRANSFERASE FROM Legionella pneumophila. To be Published
    Site NYSGXRC
    PDB Id 3lom Target Id NYSGXRC-20026a
    Molecular Characteristics
    Source Legionella pneumophila
    Alias Ids TPS33345,PF00348, 52842540 Molecular Weight 34141.59 Da.
    Residues 309 Isoelectric Point 5.60
    Sequence lvliptlnstqmnkqvidkytqrhelyleqllneiiipapqirsalhyalfsggkrirpilvylagdli dvdqgvldiiaaalelthcyslihddlpamdnddlrrgkpschkafdeatailvgdgmqalaievllmr lspllpaaqvvaitqvlvnasgisgmvsgqsldlselakssvteeqlreihllktgklilacfemvlaa qhevseqiksalrtygkhiglvfqmqddyldlyaptqilgkgrssdqanqkttfatlfnkqqleeeiav hyqiamdslrlfgskaaalieltkqlqnrsnls
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.26676
    Matthews' coefficent 2.41 Rfactor 0.22094
    Waters 135 Solvent Content 48.91

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 3
    Metals

    Jmol

     
    Google Scholar output for 3lom

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch