.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lm4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of 2,3-Dihydroxy Biphenyl dioxygenase from Rhodococcus sp. (strain RHA1). To be Published
    Site NYSGXRC
    PDB Id 3lm4 Target Id NYSGXRC-11002o
    Molecular Characteristics
    Source Unknown
    Alias Ids TPS33361,PF00903, 3.10.180.10, Q0S9X1_RHOSR Molecular Weight 40176.80 Da.
    Residues 360 Isoelectric Point 5.12
    Sequence msdarfdiahlaraelfspkpqetldfftkflgmyvthregqsvylrgyedpypwslkiteapeagmgh aamrtsspealerraksltdgnvdgtwsedqfgygktfeyqspdghnlqllweaekyvappelrskilt rpskkplqgipvkridhlnlmssdvtavkdsferhlgfrttervvdgnveigawmssnllghevacmrd mtgghgklhhlaffygtgqhnidavemfrdydiqieagpdkhgitqsqflyvfepggnrielfgeagyl hldpdaetktwqmsdidtglavggaklpwesyftygtpsplsldqhiekyahfgpgapdpdalaaelsv pdelehsravadasl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.80 Rfree 0.210
    Matthews' coefficent 2.31 Rfactor 0.184
    Waters 748 Solvent Content 46.75

    Ligand Information
    Ligands PEO (HYDROGEN) x 4;HPX ((2Z,4E)-2-HYDROXY-6-OXO-6-PHENYLHEXA-2,4-DIENOIC) x 4
    Metals FE (FE) x 4

    Jmol

     
    Google Scholar output for 3lm4

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch