.
The Open Protein Structure Annotation Network
PDB Keyword
.

3llw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Geranyltransferase from Helicobacter Pylori. To be Published
    Site NYSGXRC
    PDB Id 3llw Target Id NYSGXRC-20030a
    Molecular Characteristics
    Source Helicobacter pylori
    Alias Ids TPS33346,PF00348, 15645545 Molecular Weight 34265.48 Da.
    Residues 303 Isoelectric Point 5.44
    Sequence msspnlsfyynecerfesflknhhlhlesfhpylekaffemvlnggkrfrpklflavlcalvgqkdysn qqteyfkialsieclhtyslihddlpcmdnaalrrnhptlhakydettavligdalntysfellsnall eshiivelikilsanggikgmilgqaldcyfentplnleqltflhehktaklisaslimglvasgikde elfkwlqafglkmglcfqvlddiidvtqdeeesgktthldsaknsfvnllglerannyaqtlktevlnd ldalkpaypllqenlnallntlfkgkt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.30 Rfree 0.25245
    Matthews' coefficent 2.90 Rfactor 0.19550
    Waters 169 Solvent Content 57.64

    Ligand Information
    Ligands SO4 (SULFATE) x 9
    Metals

    Jmol

     
    Google Scholar output for 3llw

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch