.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lk5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative Geranylgeranyl pyrophosphate synthase from Corynebacterium glutamicum Atcc 13032. To be Published
    Site NYSGXRC
    PDB Id 3lk5 Target Id NYSGXRC-20008a
    Molecular Characteristics
    Source Corynebacterium glutamicum
    Alias Ids TPS31606,23308904, PF00348 Molecular Weight 40136.67 Da.
    Residues 371 Isoelectric Point 4.90
    Sequence lkdvslssfdahdldldkfpevvrdrltqfldaqeltiadigapvtdavahlrsfvlnggkrirplyaw agflaaqghknsseklesvldaaaslefiqacalihddiidssdtrrgaptvhraveadhrannfegdp ehfgvsvsilagdmalvwaedmlqdsglsaealartrdawrgmrteviggqlldiyleshanesvelad svnrfktaaytiarplhlgasiaggspqlidallhyghdigiafqlrddllgvfgdpaitgkpagddir egkrtvllalalqradkqspeaatairagvgkvtspediavitehiratgaeeeveqrisqltesglah lddvdipdevraqlralairsterrm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.198
    Matthews' coefficent 2.85 Rfactor 0.168
    Waters 194 Solvent Content 56.85

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals

    Jmol

     
    Google Scholar output for 3lk5

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch