.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lhl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative agmatinase from Clostridium difficile. To be Published
    Site NYSGXRC
    PDB Id 3lhl Target Id NYSGXRC-11305e
    Molecular Characteristics
    Source Clostridium difficile
    Alias Ids TPS31703,3.40.800.10, YP_001087365.1, PF00491 Molecular Weight 33305.96 Da.
    Residues 292 Isoelectric Point 4.86
    Sequence mknnfyhmntfmsmdknyeesnlivfgvgfdgttsnrpgarfasssmrkefygletyspfldldledyn icdygdleisvgsteqvlkeiyqetykivrdskvpfmiggehlvtlpafkavhekyndiyvihfdahtd lreeynnsknshatvikriwdivgdnkifqfgirsgtkeefkfateekhtymeiggidtfenivnmlng kniyltidldvldasvfpgtgtpepggvnyrefqeifkiiknsninivgcdivelspdydttgvstvia ckilrelcliisdkik
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.238
    Matthews' coefficent 2.18 Rfactor 0.193
    Waters 166 Solvent Content 43.58

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 2;MPD ((4S)-2-METHYL-2,4-PENTANEDIOL) x 1
    Metals MN (MANGANESE) x 4

    Jmol

     
    Google Scholar output for 3lhl

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch