.
The Open Protein Structure Annotation Network
PDB Keyword
.

3l8k

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a dihydrolipoyl dehydrogenase from Sulfolobus solfataricus. To be Published
    Site NYSGXRC
    PDB Id 3l8k Target Id NYSGXRC-11145h
    Molecular Characteristics
    Source Sulfolobus solfataricus
    Alias Ids TPS31632,3.40.50.720, NP_342988.1 Molecular Weight 50494.82 Da.
    Residues 456 Isoelectric Point 8.41
    Sequence mkydvvvigaggagyhgafrlakakynvlmadpkgelggnclysgcvpsktvreviqtawrltnianvk ipldfstvqdrkdyvqelrfkqhkrnmsqyetltfykgyvkikdpthvivktdegkeieaetrymiias gaetaklrlpgveycltsddifgyktsfrklpqdmviigagyigleiasifrlmgvqthiiemldrali tledqdivntllsilklnikfnspvtevkkikddeyeviystkdgskksiftnsvvlaagrrpvipega reiglsisktgivvdetmktnipnvfatgdanglapyyhaavrmsiaaannimangmpvdyvdvksipv tiytipslsyvgilpskarkmgieiveaeynmeedvsaqiygqkegvlklifergsmrligawmigvhs qylinelglavayglnakqlasfaeqhpstneiisytarkvi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.243
    Matthews' coefficent 2.90 Rfactor 0.193
    Waters 53 Solvent Content 57.58

    Ligand Information
    Ligands ADP (ADENOSINE-5'-DIPHOSPHATE) x 2;PO4 (PHOSPHATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 3l8k

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch