The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of probable D-alanine--poly(phosphoribitol) ligase subunit-1 from Streptococcus pyogenes. To be Published
    Site NYSGXRC
    PDB Id 3l8c Target Id NYSGXRC-11194c
    Related PDB Ids 3lgx 
    Molecular Characteristics
    Source Streptococcus pyogenes
    Alias Ids TPS31646,3.30.300.30, NP_269435.1, PF00501 Molecular Weight 56984.05 Da.
    Residues 512 Isoelectric Point 4.91
    Sequence mikdmidsieqfaqtqadfpvydclgerrtygqlkrdsdsiaafidslallakspvlvfgaqtydmlat fvaltksghayipvdvhsaperilaiieiakpsliiaieefpltiegislvslseiesaklaempyert hsvkgddnyyiiftsgttgqpkgvqishdnllsftnwmiedaafdvpkqpqmlaqppysfdlsvmywap tlalggtlfalpkelvadfkqlfttiaqlpvgiwtstpsfadmamlsddfcqakmpalthfyfdgeelt vstarklferfpsakiinaygpteatvalsaieitremvdnytrlpigypkpdsptyiidedgkelssg eqgeiivtgpavskgylnnpektaeafftfkgqpayhtgdigsltednillyggrldfqikyagyriel edvsqqlnqspmvasavavprynkehkvqnllayivvkdgvkerfdreleltkaikasvkdhmmsymmp skflyrdslpltpngkidiktlinevnnr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.41 Rfree 0.275
    Matthews' coefficent 2.49 Rfactor 0.217
    Waters 105 Solvent Content 50.70

    Ligand Information


    Google Scholar output for 3l8c

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch