.
The Open Protein Structure Annotation Network
PDB Keyword
.

3l6u

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of abc-type sugar transport system, Periplasmic component from exiguobacterium sibiricum. To be Published
    Site NYSGXRC
    PDB Id 3l6u Target Id NYSGXRC-11006s
    Molecular Characteristics
    Source Exiguobacterium sibiricum
    Alias Ids TPS31612,3.40.50.2300, PF00532, Q41FS0_9BACI Molecular Weight 35399.92 Da.
    Residues 317 Isoelectric Point 8.42
    Sequence mrfnkswllvliiwiasvlvisnlfvqketspkrnivgftivndkhefaqrlinafkaeakankyealv atsqnsrisereqilefvhlkvdaifittlddvyigsaieeakkagipvfaidrmirsdavvssitsnn qmigeqlasyiknelikqtgrstgriveitgtanvyttnerhrgflkgieneptlsivdsvsgnydpvt servmrqvidsgipfdavychnddiamgvlealkkakisgkivvgidgnraileavdmksmdatvvqsa eemmkvafsalklhtknkkipdrfytysylydgsrpipmln
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.269
    Matthews' coefficent 2.03 Rfactor 0.235
    Waters 86 Solvent Content 39.38

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 3l6u

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch