The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative short chain dehydrogenase/reductase family oxidoreductase from Aeromonas hydrophila subsp. hydrophila ATCC 7966. To be Published
    Site NYSGXRC
    PDB Id 3l6e Target Id NYSGXRC-11164i
    Molecular Characteristics
    Source Aeromonas hydrophila
    Alias Ids TPS31638,, YP_858107.1 Molecular Weight 24117.18 Da.
    Residues 225 Isoelectric Point 5.49
    Sequence mghiivtgagsglgraltiglverghqvsmmgrryqrlqeqeellgkavigiaadlahheevdvafaaa vewgglpelvlhcagvgefgpvgvytaeqirrvvesnlistilvaqqtvrligdkggvlanvlssaaqv gkaneslycaskwgmrgfleslraelkgsplrlvnlypsgirsefwdnsdhvdssgfmtpedaaaymld alearsschvtdlfigrn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.27039
    Matthews' coefficent 2.21 Rfactor 0.21877
    Waters 107 Solvent Content 44.23

    Ligand Information
    Ligands SO4 (SULFATE) x 2


    Google Scholar output for 3l6e

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch