.
The Open Protein Structure Annotation Network
PDB Keyword
.

3l3s

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an enoyl-CoA hydrotase/isomerase family protein from Silicibacter pomeroyi. To be Published
    Site NYSGXRC
    PDB Id 3l3s Target Id NYSGXRC-11252f
    Molecular Characteristics
    Source Silicibacter pomeroyi
    Alias Ids TPS31691,3.90.226.10, PF00378, YP_167562.1 Molecular Weight 27262.85 Da.
    Residues 256 Isoelectric Point 5.81
    Sequence mnemsqdgllgevlsegvltltlgrapahplsramiaalhdalrramgddhvhvlvihgpgrifcaghd lkeigrhradpdegrafvtdlfeacsalmldlahcpkptialvegiataaglqlmaacdlayaspaarf clpgvqnggfcttpavavsrvigrravtemaltgatydadwalaaglinrilpeaalathvadlagala arnqaplrrgletlnrhlelpleqayalatpvmvehfmdpgrrhldwid
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 12
    Resolution (Å) 2.32 Rfree 0.294
    Matthews' coefficent 2.25 Rfactor 0.263
    Waters 134 Solvent Content 45.30

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3l3s

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch